PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011084534.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 252aa    MW: 28381.6 Da    PI: 9.5155
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011084534.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.81.3e-393091263
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                    ke+al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  XP_011084534.1 30 KEQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTQGGTLRNVPVGGGSRKNKRSSS 91
                    6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-261782IPR003851Zinc finger, Dof-type
PfamPF027013.2E-343288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2733488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MATAWPQGIG VVRPVENPRT STEKKPRPNK EQALNCPRCN STNTKFCYYN NYSLSQPRYF  60
CKTCRRYWTQ GGTLRNVPVG GGSRKNKRSS SSSSKKVMIP NLSPPKFSPQ NPKIHDGQAL  120
NVGYNPPIYN DFAPLVQFGL DPKNPNYNNH PSHSFSLLTS TDQLLSLPVV SMHHDHFKPS  180
SLSFSLDGLG NLQNHTNSSR TLFPFEELKP VSTAHDDQLH EFGLQDHHRE HEGDHHQSNH  240
GYWSGMLSGG SW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084534.10.0PREDICTED: dof zinc finger protein DOF4.6-like
SwissprotQ8LAP81e-50DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A061G2L68e-68A0A061G2L6_THECC; F-box family protein, putative isoform 1
STRINGVIT_16s0098g01420.t018e-64(Vitis vinifera)
STRINGPOPTR_0003s14450.16e-64(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.15e-36Dof family protein